ARL4D MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295899
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human ARL4D protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: ARL4D (NP_001652.2, 1 a.a. ~ 201 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
• NCBI: NP_001652.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of ARL4D transfected lysate using anti-ARL4D MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARL4D MaxPab mouse polyclonal antibody (B01) (orb2295901).

Western Blot analysis of ARL4D expression in transfected 293T cell line by ARL4D MaxPab polyclonal antibody. Lane 1: ARL4D transfected lysate(22.2 KDa). Lane 2: Non-transfected lysate.