ARL3 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295834
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human ARL3 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: ARL3 (AAH09841, 1 a.a. ~ 182 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
• NCBI: AAH09841
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARL3 MaxPab polyclonal antibody. Western Blot analysis of ARL3 expression in human colon.

Western Blot analysis of ARL3 expression in transfected 293T cell line by ARL3 MaxPab polyclonal antibody. Lane 1: ARL3 transfected lysate(20.13 KDa). Lane 2: Non-transfected lysate.