ARL2 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295835
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human ARL2 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Immunogen: ARL2 (NP_001658.1, 1 a.a. ~ 184 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD
• NCBI: NP_001658.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARL2 MaxPab polyclonal antibody. Western Blot analysis of ARL2 expression in rat brain.

Western Blot analysis of ARL2 expression in transfected 293T cell line by ARL2 MaxPab polyclonal antibody. Lane 1: ARL2 transfected lysate(20.24 KDa). Lane 2: Non-transfected lysate.