ARID3A monoclonal antibody (M01), clone 1A11

• Catalog Number: orb2293487
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARID3A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: ARID3A (NP_005215, 317 a.a. ~ 416 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
• NCBI: NP_005215
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARID3A monoclonal antibody (M01), clone 1A11 Western Blot analysis of ARID3A expression in K-562.

Detection limit for recombinant GST tagged ARID3A is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody (M01), clone 1A11 (Cat # orb2293487). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).