You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290933 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ARID1B. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 2D2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_059989 |
Expiration Date | 12 months from date of receipt. |
ARID1B monoclonal antibody (M01), clone 2D2 Western Blot analysis of ARID1B expression in Hela S3 NE.
Detection limit for recombinant GST tagged ARID1B is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ARID1B on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (36.41 KDa).