You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
ARHGDIA MaxPab rabbit polyclonal antibody (D03)
Catalog Number: orb2295854
| Catalog Number | orb2295854 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human, Mouse |
| Immunogen | ARHGDIA (AAH16031.1, 1 a.a. ~ 204 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| NCBI | AAH16031.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in human spleen.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in Jurkat.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in mouse stomach.
Immunoprecipitation of ARHGDIA transfected lysate using anti-ARHGDIA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARHGDIA MaxPab mouse polyclonal antibody (B01).
Western Blot analysis of ARHGDIA expression in transfected 293T cell line by ARHGDIA MaxPab polyclonal antibody. Lane 1: ARHGDIA transfected lysate(22.55 KDa). Lane 2: Non-transfected lysate.
