You have no items in your shopping cart.
Cart summary
Item 1 of 6
Item 1 of 6
ARHGAP1 polyclonal antibody (A01)
Catalog Number: orb2295866
| Catalog Number | orb2295866 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant ARHGAP1. |
| Species/Host | Mouse |
| Clonality | Polyclonal |
| Tested applications | ELISA, WB |
| Reactivity | Human, Mouse, Rat |
| Immunogen | ARHGAP1 (AAH18118, 340 a.a. ~ 439 a.a) partial recombinant protein with GST tag. |
| Conjugation | Unconjugated |
| Protein Sequence | GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL |
| NCBI | AAH18118 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | 50 % glycerol |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
ARHGAP1 polyclonal antibody (A01), Western Blot analysis of ARHGAP1 expression in MES-SA/Dx5.
ARHGAP1 polyclonal antibody (A01), Western Blot analysis of ARHGAP1 expression in Jurkat.
ARHGAP1 polyclonal antibody (A01), Western Blot analysis of ARHGAP1 expression in NIH/3T3.
ARHGAP1 polyclonal antibody (A01), Western Blot analysis of ARHGAP1 expression in PC-12.
ARHGAP1 polyclonal antibody (A01), Western Blot analysis of ARHGAP1 expression in Raw 264.7.
Western Blot detection against Immunogen (37 KDa).
