Argininosuccinate Lyase/ASL Antibody

• Catalog Number: orb402396
• Category: Antibodies
• Description: Argininosuccinate Lyase/ASL Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase/ASL (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 51658 MW
• UniProt ID: P04424
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Argininosuccinate lyase;ASAL;4.3.2.1;Arginosuccina
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Argininosuccinate Lyase/ASL using anti-Argininosuccinate Lyase/ASL antibody.Lane 1:rat liver tissue;2:rat kidney tissue;3:rat lung tissue;4:mouse liver tissue.