You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402396 |
---|---|
Category | Antibodies |
Description | Argininosuccinate Lyase/ASL Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human Argininosuccinate Lyase/ASL (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 51658 MW |
UniProt ID | P04424 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Argininosuccinate lyase;ASAL;4.3.2.1;Arginosuccina Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Argininosuccinate Lyase/ASL using anti-Argininosuccinate Lyase/ASL antibody.Lane 1:rat liver tissue;2:rat kidney tissue;3:rat lung tissue;4:mouse liver tissue.
WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating