You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295892 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human ARG1 protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Immunogen | ARG1 (AAH20653.1, 1 a.a. ~ 322 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
NCBI | AAH20653.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in HepG2.
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in human liver.
Western Blot analysis of ARG1 expression in transfected 293T cell line by ARG1 MaxPab polyclonal antibody. Lane 1: ARG1 transfected lysate(35.42 KDa). Lane 2: Non-transfected lysate.