ARF5 monoclonal antibody (M01), clone 1B4

• Catalog Number: orb2295896
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARF5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B4
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
• NCBI: AAH03043
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ARF5 monoclonal antibody (M01), clone 1B4 Western Blot analysis of ARF5 expression in A-431.

ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in HeLa.

ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in PC-12.

ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in Raw 264.7.

Detection limit for recombinant GST tagged ARF5 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15 ug/ml].

Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody (M01), clone 1B4. Lane 1: ARF5 transfected lysate(20.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).