You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295896 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ARF5. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B4 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 Kappa |
Immunogen | ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR |
NCBI | AAH03043 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ARF5 monoclonal antibody (M01), clone 1B4 Western Blot analysis of ARF5 expression in A-431.
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in HeLa.
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in PC-12.
ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in Raw 264.7.
Detection limit for recombinant GST tagged ARF5 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15 ug/ml].
Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody (M01), clone 1B4. Lane 1: ARF5 transfected lysate(20.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).