AREG monoclonal antibody (M06), clone 3E4

• Catalog Number: orb2295905
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AREG.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: AREG (AAH09799, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKK
• Tested applications: ELISA, PLA, WB
• Clone Number: 3E4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH09799

AREG monoclonal antibody (M06), clone 3E4. Western Blot analysis of AREG expression in human pancreas.

Detection limit for recombinant GST tagged AREG is 0.3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between CCND3 and AREG. HeLa cells were stained with anti-CCND3 rabbit purified polyclonal 1:1200 and anti-AREG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (37.73 KDa).