AREB6/ZEB1 Antibody (monoclonal, 8B12D7)

• Catalog Number: orb1184754
• Category: Antibodies
• Description: AREB6/ZEB1 Antibody (monoclonal, 8B12D7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 8B12D7
• Tested applications: ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence of human AREB6/ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Immunofluorescence, 5 μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 200 kDa
• UniProt ID: P37275
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human glioblastoma tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human thyroid cancer tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of rat brain tissue.

IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in a paraffin-embedded section of human glioma tissue.

IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody. AREB6/ZEB1 was detected in an immunocytochemical section of U87 cells.

Western blot analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody.