You have no items in your shopping cart.
Cart summary
Aquaporin-4/AQP4 Protein, Mouse, Recombinant (His)
Catalog Number: orb1976940
| Catalog Number | orb1976940 |
|---|---|
| Category | Proteins |
| Description | Aquaporin-4/AQP4 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.9 kDa and the accession number is P55088. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 9.9 kDa (predicted) |
| UniProt ID | P55088 |
| Protein Sequence | CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | Aquaporin-4/AQP4 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 9.9 kDa and the accession number is P55088. |
| Expression Region | 253-323 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
