Aquaporin 2/AQP2 Antibody

• Catalog Number: orb308769
• Category: Antibodies
• Description: Aquaporin 2/AQP2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28837 MW
• UniProt ID: P41181
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Aquaporin-2;AQP-2;ADH water channel;Aquaporin-CD;A
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-AQP2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Lane 1:rat kidney tissue; 2:rat NRK cell; 3:rat PC-12 cell; 4:mouse kidney tissue; 5:mouse HBZY cell; 6:mouse RAW264.7 cell.

IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Human Renal Cancer Tissue.

IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Rat Kidney Tissue.

IHC analysis of Aquaporin 2 using anti-Aquaporin 2 antibody.Aquaporin 2 was detected in paraffin-embedded section of Mouse Kidney Tissue.