Aquaporin 1/AQP1 Antibody

• Catalog Number: orb308768
• Category: Antibodies
• Description: Aquaporin 1/AQP1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IF, IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28526 MW
• UniProt ID: P29972
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Aquaporin-1;AQP-1;Aquaporin-CHIP;Urine water chann
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SH-SY5Y cells using anti-AQP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of AQP1 using anti-AQP1 antibody.Lane 1:rat kidney tissue;2:mouse kidney tissue;3:mouse lung tissue.

IF analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human lung cancer tissue.

IF analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of rat kidney tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human bladder urothelial carcinoma tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human liver cancer tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human lung cancer tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human rectal cancer tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of human tonsil tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of mouse kidney tissue.

IHC analysis of AQP1 using anti-AQP1 antibody. AQP1 was detected in a paraffin-embedded section of rat kidney tissue.