AQP4 / Aquaporin 4 Antibody

• Catalog Number: orb1535799
• Category: Antibodies
• Description: AQP4 / Aquaporin 4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 244-323 of human AQP4 (NP_001641.1). AGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Dilution range: IHC, IHC-P (1:100), WB (1:500 - 1:1000)
• Conjugation: Unconjugated
• Target: AQP4 / Aquaporin 4
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: AQP4, Aquaporin type4, Aquaporin 4, Aquaporin-4, H
• Note: For research use only
• Application notes: Further information: The predicted MW is 32kDa/34kDa, while the observed MW by Western blot was 36kDa.
• Expiration Date: 12 months from date of receipt.