You have no items in your shopping cart.
Cart summary
APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc)
Catalog Number: orb1976326
| Catalog Number | orb1976326 |
|---|---|
| Category | Proteins |
| Description | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 22.7 kDa (predicted) |
| UniProt ID | P63546 |
| Protein Sequence | MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Streptococcus pyogenes |
| Biological Activity | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. APT Protein, S. pyogenes serotype M1, Recombinant (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 22.7 kDa and the accession number is P63546. |
| Expression Region | 1-172 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
