APRT MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295955
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human APRT protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: No additive
• Immunogen: APRT (NP_000476.1, 1 a.a. ~ 180 a.a) full-length human protein.
• Protein Sequence: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000476.1

APRT MaxPab rabbit polyclonal antibody. Western Blot analysis of APRT expression in K-562.

Immunoprecipitation of APRT transfected lysate using anti-APRT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with APRT purified MaxPab mouse polyclonal antibody (B01P) (orb2295956).

Western Blot analysis of APRT expression in transfected 293T cell line by APRT MaxPab polyclonal antibody. Lane 1: APRT transfected lysate(19.60 KDa). Lane 2: Non-transfected lysate.