APOH monoclonal antibody (M01A), clone 3F10

• Catalog Number: orb2295961
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant APOH.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgM Kappa
• Immunogen: APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
• NCBI: NP_000033
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APOH monoclonal antibody (M01A), clone 3F10 Western Blot analysis of APOH expression in HL-60.

Western Blot detection against Immunogen (37.84 KDa).