APOC4 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295967
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human APOC4 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Immunogen: APOC4 (NP_001637.1, 1 a.a. ~ 127 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
• NCBI: NP_001637.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APOC4 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOC4 expression in rat brain.

Western Blot analysis of APOC4 expression in transfected 293T cell line by APOC4 MaxPab polyclonal antibody. Lane 1: APOC4 transfected lysate(14.60 KDa). Lane 2: Non-transfected lysate.