APOC4 monoclonal antibody (M01), clone 3D10

• Catalog Number: orb2295966
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant APOC4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D10
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a kappa
• Immunogen: APOC4 (AAH20723.1, 27 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
• NCBI: AAH20723.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of APOC4 transfected lysate using anti-APOC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOC4 MaxPab rabbit polyclonal antibody.

Western Blot analysis of APOC4 expression in transfected 293T cell line by APOC4 monoclonal antibody (M01), clone 3D10. Lane 1: APOC4 transfected lysate(14.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.85 KDa).