You have no items in your shopping cart.
Cart summary
APOB Protein, Human, Recombinant (Yeast, His)
Catalog Number: orb1978969
| Catalog Number | orb1978969 |
|---|---|
| Category | Proteins |
| Description | APOB Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
| UniProt ID | P04114 |
| MW | 13.2 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | APOB Protein, Human, Recombinant (Yeast, His) is expressed in Yeast. |
| Expression Region | 28-127 aa |
| Storage | -20°C |
| Note | For research use only |
