APOB monoclonal antibody (M14), clone 3E5

• Catalog Number: orb2295978
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant APOB.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: APOB (NP_000375.1, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
• NCBI: NP_000375.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged APOB is 0.03 ng/ml as a capture antibody.

Western Blot analysis of APOB expression in transfected 293T cell line by APOB monoclonal antibody (M14), clone 3E5. Lane 1: APOB transfected lysate (Predicted MW: 11.11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).