You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295987 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human APOA1 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein. |
Protein Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Tested applications | PLA, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000030.1 |
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in HeLa.
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in human kidney.
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in mouse brain.
Proximity Ligation Analysis of protein-protein interactions between APOA1 and FGA. HeLa cells were stained with anti-APOA1 rabbit purified polyclonal 1:1200 and anti-FGA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 MaxPab polyclonal antibody. Lane 1: APOA1 transfected lysate(30.80 KDa). Lane 2: Non-transfected lysate.