You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295986 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant APOA1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | S1 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
NCBI | AAH05380 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
APOA1 monoclonal antibody (M01), clone 3A11-1A9. Western Blot analysis of APOA1 expression in human kidney.
Detection limit for recombinant GST tagged APOA1 is approximately 0.03 ng/ml as a capture antibody.
Immunoprecipitation of APOA1 transfected lysate using anti-APOA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOA1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 monoclonal antibody (M01), clone 3A11-1A9. Lane 1: APOA1 transfected lysate (Predicted MW: 30.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (55.11 KDa).