APOA1 monoclonal antibody (M01), clone S1

• Catalog Number: orb2295986
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant APOA1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S1
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: APOA1 (AAH05380, 1 a.a. ~ 267 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
• NCBI: AAH05380
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APOA1 monoclonal antibody (M01), clone 3A11-1A9. Western Blot analysis of APOA1 expression in human kidney.

Detection limit for recombinant GST tagged APOA1 is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of APOA1 transfected lysate using anti-APOA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOA1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 monoclonal antibody (M01), clone 3A11-1A9. Lane 1: APOA1 transfected lysate (Predicted MW: 30.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (55.11 KDa).