API5 monoclonal antibody (M01), clone 1C2

• Catalog Number: orb2291875
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant API5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C2
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: API5 (AAH17709, 400 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
• NCBI: AAH17709
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

API5 monoclonal antibody (M01), clone 1C2 Western Blot analysis of API5 expression in Hela S3 NE.

Detection limit for recombinant GST tagged API5 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to API5 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to API5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (37.18 KDa).