APEX1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2296013
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human APEX1 protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: APEX1 (NP_001632, 1 a.a. ~ 318 a.a) full-length human protein.
• Protein Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
• Tested applications: IF, IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001632

APEX1 MaxPab polyclonal antibody. Western Blot analysis of APEX1 expression in human liver.

Immunofluorescence of purified MaxPab antibody to APEX1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of purified MaxPab antibody to APEX1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml].

Western Blot analysis of APEX1 expression in transfected 293T cell line by APEX1 MaxPab polyclonal antibody. Lane 1: APEX1 transfected lysate(34.98 KDa). Lane 2: Non-transfected lysate.