APEX1 MaxPab rabbit polyclonal antibody (D02)

• Catalog Number: orb2296011
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human APEX1 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IP, WB
• Reactivity: Human
• Immunogen: APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
• NCBI: NP_001632.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APEX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APEX1 expression in K-562.

Immunofluorescence of purified MaxPab antibody to APEX1 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoprecipitation of APEX1 transfected lysate using anti-APEX1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with APEX1 purified MaxPab mouse polyclonal antibody (B01P) (orb2296013).

Western Blot analysis of APEX1 expression in transfected 293T cell line by APEX1 MaxPab polyclonal antibody. Lane 1: APEX1 transfected lysate(34.98 KDa). Lane 2: Non-transfected lysate.