APE1 Antibody (Acetyl-Lys6)

• Catalog Number: orb2240327
• Category: Antibodies
• Description: APE1 Antibody (Acetyl-Lys6)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IF, IHC-P, WB
• Isotype: IgG
• Immunogen: The antiserum was produced against synthesized Acetyl-peptide derived from human APE1 around the Acetylation site of Lys6.
• Form/Appearance: Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
• Conjugation: Unconjugated
• MW: 35 kDa
• UniProt ID: P27695
• Protein Sequence: Synthetic peptide located within the following region: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD
• Storage: -20°C
• Buffer/Preservatives: Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol
• Alternative names: AP endonuclease class I;AP lyase;APE;APE1;APEN;APE
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1000IHC: 1:50~100ELISA: 1:10000
• Expiration Date: 12 months from date of receipt.