AP2B1 monoclonal antibody (M01J), clone 2D5

• Catalog Number: orb2296322
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant AP2B1.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D5
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
• NCBI: NP_001273.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Detection limit for recombinant GST tagged AP2B1 is 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (33.11 KDa).