AP1S1 purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2294372
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human AP1S1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: AP1S1 (NP_001274.1, 1 a.a. ~ 158 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
• NCBI: NP_001274.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of AP1S1 expression in transfected 293T cell line by AP1S1 MaxPab polyclonal antibody. Lane 1: AP1S1 transfected lysate(18.70 KDa). Lane 2: Non-transfected lysate.