You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296043 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant ANXA5. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F4-1A5 |
Tested applications | ELISA, IF, IHC-P, IP, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
NCBI | AAH01429 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Western Blot analysis of ANXA5 expression in HeLa.
Detection limit for recombinant GST tagged ANXA5 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10 ug/ml].
Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].
Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 MaxPab rabbit polyclonal antibody.
Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Lane 1: ANXA5 transfected lysate(35.9 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (60.94 KDa).