ANXA5 monoclonal antibody (M01), clone 1F4-1A5

• Catalog Number: orb2296043
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ANXA5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F4-1A5
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• NCBI: AAH01429
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Western Blot analysis of ANXA5 expression in HeLa.

Detection limit for recombinant GST tagged ANXA5 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml].

Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 MaxPab rabbit polyclonal antibody.

Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody (M01), clone 1F4-1A5. Lane 1: ANXA5 transfected lysate(35.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (60.94 KDa).