You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2296045 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ANXA5 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | No additive |
Immunogen | ANXA5 (NP_001145.1, 1 a.a. ~ 320 a.a) full-length human protein. |
Protein Sequence | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Tested applications | IP, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001145.1 |
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in HepG2.
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in human liver.
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in mouse liver.
Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 purified MaxPab mouse polyclonal antibody (B01P) (orb2296046).
Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 MaxPab polyclonal antibody. Lane 1: ANXA5 transfected lysate(35.9 KDa). Lane 2: Non-transfected lysate.