You have no items in your shopping cart.
Cart summary
Item 1 of 10
Item 1 of 10
ANXA4 MaxPab rabbit polyclonal antibody (D01)
Catalog Number: orb2296050
| Catalog Number | orb2296050 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human ANXA4 protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human, Mouse, Rat |
| Immunogen | ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD |
| NCBI | NP_001144.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in A-431.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in K-562.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse brain.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse intestine.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in PC-12.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in rat brain.
ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in Raw 264.7.
Immunoprecipitation of ANXA4 transfected lysate using anti-ANXA4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA4 purified MaxPab mouse polyclonal antibody (B01P) (orb2296051).
Western Blot analysis of ANXA4 expression in transfected 293T cell line by ANXA4 MaxPab polyclonal antibody. Lane 1: ANXA4 transfected lysate(36.10 KDa). Lane 2: Non-transfected lysate.
