ANXA11 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2296039
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human ANXA11 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: ANXA11 (NP_001148.1, 1 a.a. ~ 505 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
• NCBI: NP_001148.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ANXA11 MaxPab polyclonal antibody. Western Blot analysis of ANXA11 expression in human pancreas.

Immunofluorescence of purified MaxPab antibody to ANXA11 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of ANXA11 expression in transfected 293T cell line by ANXA11 MaxPab polyclonal antibody. Lane 1: ANXA11 transfected lysate(55.55 KDa). Lane 2: Non-transfected lysate.