Anti-Rab9a

• Catalog Number: orb420052
• Category: Antibodies
• Description: Goat polyclonal antibody to Rab9a. Rab9a belongs to the small GTPase superfamily, Rab family. This protein may be involved in endosome-to-Golgi transport.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to the C-terminus of Rab9a produced in E. coli.. Antigen Sequence: QNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPKPNSSCC
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:250-1:2,000
• Conjugation: Unconjugated
• Target: RAB9, member RAS oncogene family
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: RAB9, RAB9A, member RAS oncogene family, ras-relat
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.