You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334962 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to mouse Rab8. Rab8 belongs to the small GTPase superfamily, Rab family. It has cell-type specific function during the process of exocytosis and coordinates regulation of the cytoskeleton. Rab8 also appears to interface with endocytic recycling circuits. At the molecular level, this GTPase regulates both the export of vesicles from the trans-Golgi apparatus, and the directed translocation along actin filaments and microtubules. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli.. Antigen Sequence: MEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:250-1:1,000 |
Conjugation | Unconjugated |
Target | RAB8B, member RAS oncogene family |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | RAB8A, RAB8B, RAS-associated protein RAB8A, ras-re Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of staining of GFP Rab8a lysate using Rab8b antibody
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |