You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb11629 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to mouse Rab5b. Rab5b belongs to the small GTPase superfamily, Rab family. Rab5b is an Early Endosome Marker and functions as a key regulator of vesicular trafficking during early endocytosis. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | IF, IHC-Fr, IHC-P, WB |
Reactivity | Canine, Human, Monkey, Mouse, Rat |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 115 aa to the C-terminus of mouse Rab5b produced in E. coli.. Antigen Sequence: VKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:250-1:1,000, IF:1:50-1:250, IHC-P:1:100-1:500, IHC-F:1:100-1:500 |
Conjugation | Unconjugated |
Target | RAB5B, member RAS oncogene family |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | RAB5B, RAS-associated protein RAB5B, ras-related p Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of transfected 293HEK cell lysate using Rab5b antibody
Confocal immunofluorescence analysis of B6-RPE07 cells using Rab5b antibody
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |