You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb11622 |
---|---|
Category | Antibodies |
Description | Goat polyclonal antibody to mouse Rab27a. Rab27a belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in lysosome-related vesicle transport and small GTPase mediated signal transduction. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | IF, IHC-Fr, IHC-P, WB |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.. Antigen Sequence: MHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:250-1:2,000, IF:1:50-1:200, IHC-P:1:50-1:400, IHC-F:1:50-1:400 |
Form/Appearance | Polyclonal antibody supplied as a 200 or 500 µl (1 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
Conjugation | Unconjugated |
Target | RAB27A, member RAS oncogene family |
Storage | For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | GS2, GTP-binding protein Ram, rab-27, ras-related Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of At-T20 cells lysate using Rab27a antibody
Immunohistochemical analysis of mouse retina using Rab27a antibody.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, FC, ICC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep | |
Goat | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |