Anti-Rab25

• Catalog Number: orb11633
• Category: Antibodies
• Description: RAB25 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. Members of the RAB11 subfamily, including RAB25, control the return of internalized membrane-associated moieties to the cell surface.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab25 produced in E. coli.. Antigen Sequence: MIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAITLGNAQAGQDPGPGEKRACCISL
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:250-1:2,000, IF:1:25-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Conjugation: Unconjugated
• Target: RAB25, member RAS oncogene family
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: CATX-8, RAB11C antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of transfected 293HEK cell lysate using Rab25 antibody

Immunofluorescence analysis of Hepa1-6 cells using Rab25 antibody at 1:50 dilution.