Anti-Rab20

• Catalog Number: orb153329
• Category: Antibodies
• Description: Goat polyclonal antibody to RAB20. RAB20 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein localizes to Golgi apparatus and plays a role in apical endocytosis/recycling.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 130 aa to the C-terminus of Rab20 produced in E. coli.. Antigen Sequence: MEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:250-1:2,000
• Conjugation: Unconjugated
• Target: RAB20, member RAS oncogene family
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: Ras-related protein Rab-20 antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HEK293 cell line lysate using Rab20 antibody.