Anti-Rab11b

• Catalog Number: orb180472
• Category: Antibodies
• Description: Goat polyclonal antibody to mouse Rab11b. Rab11 belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and plays essential roles in vesicle and granule targeting. Similar to Rab11a, it has been shown that Rab11b associates with recycling endosomes.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab11b produced in E. coli.. Antigen Sequence: MVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQRPNKLQCCQSL
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:250-1:2,000, IF:1:50-1:250, IHC-P:1:100-1:400, IHC-F:1:100-1:400
• Conjugation: Unconjugated
• Target: RAB11b, member RAS oncogene family
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: GTP-binding protein YPT3; member of RAS oncogene f
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HEK293 and At-T20 cell line lysate using Rab11b antibody.