Anti-NPY1R

• Catalog Number: orb611196
• Category: Antibodies
• Description: Goat polyclonal antibody to NPY1R. This protein belongs to the G-protein-coupled receptor superfamily. It is a transmembrane protein that mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. Activation of Y1 receptors may result in mobilization of intracellular calcium and inhibition of adenylate cyclase activity.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 300 aa to the C-terminus of human NPY1R produced in E. coli.. Antigen Sequence: ENKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:500-1:5,000
• Conjugation: Unconjugated
• Target: Neuropeptide Y receptor Y1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: neuropeptide Y receptor Y1, NPYR, NPY1-R antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.