You have no items in your shopping cart.
Cart summary
anti-Membrane Protein (SARS-CoV-2)
Catalog Number: orb1463305
| Catalog Number | orb1463305 |
|---|---|
| Category | Antibodies |
| Description | Membrane protein (E) is one of the structural proteins of the virus. This glycoprotein that is the most abundant protein in the coronavirus envelope might act as a scaffold for the co-assembly of the complex of structural and accessory proteins that form the viral envelope. |
| Species/Host | Goat |
| Clonality | Polyclonal |
| Tested applications | WB |
| Reactivity | Virus |
| Isotype | IgG |
| Immunogen | Antigen: Affinity purified recombinant fusion protein using the internal sequence of Membrane protein (residues 150 to 215) and produced in E. coli.. Antigen Sequence: LRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSD |
| Antibody Type | Primary Antibody |
| Concentration | 1 mg/ml |
| Dilution range | WB:1:500-1:2,000 |
| Conjugation | Unconjugated |
| Target | Membrane Protein (SARS-CoV-2) |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Alternative names | ORF5, M SARS Coronavirus-2 antibody. Read more... |
| Note | For research use only |
| Application notes | The antibody solution should be gently mixed before use. |
| Expiration Date | 12 months from date of receipt. |
