Anti-Clathrin HC

• Catalog Number: orb180469
• Category: Antibodies
• Description: Goat polyclonal to Clathrin Heavy Chain. Clathrin is formed by three clathrin heavy chains and three light chains. This protein is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in endocytosis of a variety of macromolecules and in the intracellular trafficking of receptors.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 50 aa to N-terminus of human CLTC produced in E. coli.. Antigen Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:250-1:1,000, IF:1:25-1:250
• Conjugation: Unconjugated
• Target: Clathrin, heavy chain (Hc)
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: clathrin, clathrin heavy chain 1, clathrin heavy p
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of At-T20 cell line lysate using Clathrin HC antibody.

Confocal immunofluoroscence analysis of Hepa1-6 cells using Clathrin HC antibody.