Anti-CD9

• Catalog Number: orb1945893
• Category: Antibodies
• Description: CD9 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. This protein functions in many cellular processes including differentiation, adhesion, and signal transduction, playing a critical role in the suppression of cancer cell motility and metastasis.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 115 aa to 195 aa of human CD9 produced in E. coli.. Antigen Sequence: HKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKF
• Antibody Type: Primary Antibody
• Concentration: 3 mg/ml
• Dilution range: WB:1:1,000-1:2,000
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Conjugation: Unconjugated
• Target: CD9
• Storage: For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: 5H9 Antigen, BA2, BA-2/P24 Antigen 3, BTCC-1, Cell
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.