Anti-CCBE1

• Catalog Number: orb1945896
• Category: Antibodies
• Description: Goat polyclonal antibody to CCBE1. CCBE1 is thought to function in extracellular matrix remodeling and migration. It is required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 389 aa to the C-terminus of human CCBE1 produced in E. coli.. Antigen Sequence: SCRKRCSGTGLTLQQRSSLYLRNFPATQKPWTWALEMTIQEELRQET
• Antibody Type: Primary Antibody
• Concentration: 3 mg/ml
• Dilution range: WB:1:1,000-1:5,000
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
• Conjugation: Unconjugated
• Target: collagen and calcium binding EGF domains 1 antibody
• Storage: For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: collagen and calcium binding EGF domains 1 antibod
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.