You have no items in your shopping cart.
Cart summary
Item 1 of 1
ANPEP monoclonal antibody (M05), clone 1G1
Catalog Number: orb2296077
| Catalog Number | orb2296077 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant ANPEP. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1G1 |
| Tested applications | ELISA |
| Reactivity | Human |
| Isotype | IgG1 Kappa |
| Immunogen | ANPEP (AAH58928.1, 858 a.a. ~ 967 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | DATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK |
| NCBI | AAH58928.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ANPEP is 0.1 ng/ml as a capture antibody.
