ANO1 Peptide - middle region

• Catalog Number: orb1997942
• Category: Proteins
• Description: ANO1 Peptide - middle region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: PRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVKLTD
• UniProt ID: Q5XXA6
• MW: 70 kDa
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: DOG1, TAOS2, ORAOV2, TMEM16A
• Note: For research use only
• NCBI: NP_060513.5