Annexin VIII/ANXA8 Antibody

• Catalog Number: orb389456
• Category: Antibodies
• Description: Annexin VIII/ANXA8 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 36881 MW
• UniProt ID: P13928
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Annexin A8 ;Annexin VIII ;Annexin-8 ;Vascular anti
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-Annexin VIII antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Annexin VIII using anti-Annexin VIII antibody.Lane 1:human HeLa cell; 2:human placenta tissue; 3:human A549 cell.